PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK02804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 350aa    MW: 39011.4 Da    PI: 4.5365
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK02804.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.4e-4761301128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                l+pGfrFhPtd elv++yLk+kv gk  +   +i+evdiyk+ PwdLp k   ++ +w+fF++r kkya+g+r nra++ gyWk+tgkd++v++ ++e+v
  PK02804.1   6 LAPGFRFHPTDVELVKYYLKRKVLGKGSTG--TIPEVDIYKYTPWDLPDKSPIKDLKWFFFCPRVKKYASGERMNRAAEGGYWKTTGKDRDVKH-NNEVV 102
                579************************655..7***************88888999**************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g  ktLvf++g  pkg +tdWvmhey+l
  PK02804.1 103 GAIKTLVFHTGGPPKGDRTDWVMHEYTL 130
                **************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-555153IPR003441NAC domain
PROSITE profilePS5100552.0236153IPR003441NAC domain
PfamPF023656.6E-268130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MRKGFLAPGF RFHPTDVELV KYYLKRKVLG KGSTGTIPEV DIYKYTPWDL PDKSPIKDLK  60
WFFFCPRVKK YASGERMNRA AEGGYWKTTG KDRDVKHNNE VVGAIKTLVF HTGGPPKGDR  120
TDWVMHEYTL MEQGLKNIGV VQDSYVLCVV FKKEGPGPKN GAQYGAPFVE EDWTTDDEND  180
SCLDADPFAI MSVSDVLPPT TGHTASSSRA PESISIEGAP ETVMSETTND DDMVSLLHYF  240
VEEDHPQLNE INKDATNYLA QQQVACPDND IFGGLGNLDN LAGLNWDPNW EDGSISAHNG  300
LSFLELKDLD APLTHGLQSF LWDYEIGNDQ FGADAAAIQN WPSHDDRSPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-43615917171NO APICAL MERISTEM PROTEIN
1ut4_B4e-43615917171NO APICAL MERISTEM PROTEIN
1ut7_A4e-43615917171NO APICAL MERISTEM PROTEIN
1ut7_B4e-43615917171NO APICAL MERISTEM PROTEIN
3swm_A5e-43615920174NAC domain-containing protein 19
3swm_B5e-43615920174NAC domain-containing protein 19
3swm_C5e-43615920174NAC domain-containing protein 19
3swm_D5e-43615920174NAC domain-containing protein 19
3swp_A5e-43615920174NAC domain-containing protein 19
3swp_B5e-43615920174NAC domain-containing protein 19
3swp_C5e-43615920174NAC domain-containing protein 19
3swp_D5e-43615920174NAC domain-containing protein 19
4dul_A4e-43615917171NAC domain-containing protein 19
4dul_B4e-43615917171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090859.11e-111NAC domain-containing protein 78
SwissprotQ9FY822e-86NAC82_ARATH; NAC domain-containing protein 82
TrEMBLW9QLV41e-111W9QLV4_9R
STRINGVIT_04s0044g01220.t015e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.44e-84NAC domain containing protein 82